Dog Tools

English Cocker Spaniel Lifespan & Health Guide

The typical English Cocker Spaniel lives 12–14 years, with a median of 13 years.

The English Cocker Spaniel is a compact, sturdy sporting dog bred for flushing and retrieving game birds in dense cover. Distinguished from the American Cocker Spaniel by a longer muzzle, flatter skull, and leggier build, the English Cocker is a merry, enthusiastic worker with an ever-wagging tail. Their gentle, affectionate nature and eager-to-please attitude make them outstanding family companions who thrive on both field work and human connection.

1214

years lifespan

2834

lbs (male)

1617

inches tall (male)

high

energy level

How Long Do English Cocker Spaniels Live?

English Cocker Spaniels have a lifespan of 12–14 years, with a median of 13 years. The main health factors that affect how long a English Cocker Spaniel lives:

  • progressive retinal atrophy (PRA)
  • hip dysplasia
  • ear infections due to pendulous ears
  • obesity
  • kidney disease

Temperament

MerryAffectionateEager to please

How Old Is Your English Cocker Spaniel in Human Years?

Use our breed-specific calculator to find out, plus get personalised health and care guidance for your dog’s exact age.

Open English Cocker Spaniel Age Calculator

English Cocker Spaniel Size & Weight

2834 lbs

Male weight

2632 lbs

Female weight

1617

Male height

1516

Female height

Size category: medium · Group: Sporting

Common English Cocker Spaniel Health Problems

Progressive Retinal Atrophy (PRA)

A group of inherited degenerative eye diseases that cause the photoreceptor cells in the retina to gradually deteriorate, leading to progressive vision loss and eventual blindness. English Cocker Spaniels are particularly susceptible to prcd-PRA (progressive rod-cone degeneration), which typically begins with night blindness and progresses to total vision loss. The condition is painless but irreversible.

Typical onset: 48 years

Ear Infections (Otitis Externa)

English Cocker Spaniels are among the breeds most prone to chronic ear infections due to their long, heavy, pendulous ears that trap moisture and reduce air circulation in the ear canal. The warm, humid environment inside the ear creates ideal conditions for bacterial and yeast overgrowth. Recurring infections can lead to chronic ear canal changes, pain, and hearing loss if not managed proactively.

Typical onset: 0.53 years

Hip Dysplasia

A developmental condition where the hip joint forms improperly, causing the femoral head and acetabulum to fit loosely. This leads to abnormal wear, inflammation, arthritis, and pain over time. While English Cockers are a medium-sized breed, they have a notable incidence of hip dysplasia that can impact their active sporting lifestyle. The condition can range from mild laxity to severe malformation requiring surgical intervention.

Typical onset: 14 years

Familial Nephropathy (FN)

An inherited kidney disease specific to English Cocker Spaniels caused by a defect in the type IV collagen of the glomerular basement membrane. Affected dogs develop progressive kidney failure, often at a young age. The condition is autosomal recessive, meaning both parents must carry the gene. It is one of the most serious hereditary conditions in the breed and can be fatal.

Typical onset: 0.52 years

Cocker Rage Syndrome (Sudden Onset Aggression)

A rare but well-documented behavioural condition seen primarily in English Cocker Spaniels, particularly in solid-coloured dogs (especially golden/red). Affected dogs display sudden, unprovoked episodes of intense aggression followed by confusion or apparent unawareness of the event. The condition is thought to have a genetic component and may be related to seizure-like activity. It is distinct from normal aggression and is not caused by poor training.

Typical onset: 13 years

Recommended Health Screenings

Breed-specific tests and evaluations recommended for English Cocker Spaniels:

  • prcd-PRA DNA test
  • Familial Nephropathy (FN) DNA test
  • OFA hip evaluation (radiographs)
  • Annual ophthalmologic examination (CERF/OFA)
  • Hearing evaluation (BAER test)
  • Thyroid panel

Typical Veterinary Costs

English Cocker Spaniels are generally rated medium on the annual veterinary cost scale, based on breed-specific health risks, known chronic conditions, and typical screening requirements. Routine wellness care plus budget for breed-specific screening tests.

When Is a English Cocker Spaniel Considered Senior?

English Cocker Spaniels are generally considered senior at around 9 years of age. At this point, you should increase vet visits to twice yearly and watch for age-related health changes.

Check your English Cocker Spaniel’s age in human years →

English Cocker Spaniel Exercise Needs

Adult English Cocker Spaniels need 6090 minutes of exercise per day. Adult English Cockers are active sporting dogs that need significant daily exercise to remain physically and mentally healthy. They excel at activities combining physical and mental challenges such as agility, flyball, and field work. Under-exercised Cockers often develop destructive behaviours or excessive barking. Two good walks per day plus play sessions is the minimum for this energetic breed.

brisk walksoff-lead runningretrievingswimmingagilityfield workscent trails

Cautions: dry ears after any water activity; check for ticks and burrs in feathering after countryside walks; maintain recall training; provide mental stimulation alongside physical exercise

English Cocker Spaniel Diet & Nutrition

Adult English Cocker Spaniels typically eat 1.52.5 cups of high-quality adult formula for medium breeds with good protein levels per day, split into 2 meals. English Cockers are notoriously food-driven and will overeat given the opportunity. Measure all food precisely and include treats in daily calorie calculations. Use food-dispensing puzzle toys to slow eating and provide mental stimulation. If the dog is very active (field work, agility), caloric needs may be higher. Use ear covers or a snood during meals to keep those long ears out of the food bowl.

Key nutrients: lean animal protein for muscle maintenance, omega-3 and omega-6 fatty acids for coat and skin, glucosamine for joint health, fibre for digestive health, taurine for heart health

English Cocker Spaniels are one of the most food-motivated breeds and are highly prone to obesity. Their soulful eyes and expert begging behaviour make it difficult for owners to resist extra treats. Maintain strict portion control, never free-feed, and ensure all family members follow the same feeding rules. Treats should not exceed 10% of daily calories. A healthy Cocker has visible waist definition and easily palpable ribs. Even moderate excess weight significantly impacts joint health, exercise tolerance, and lifespan.

English Cocker Spaniel Dental Care

English Cocker Spaniels have a well-proportioned muzzle that provides good tooth spacing compared to brachycephalic breeds, but they are still susceptible to periodontal disease without consistent care. Their food-driven nature means they chew enthusiastically, which can help with mechanical plaque removal but also means they readily chew inappropriate items. Daily brushing combined with dental-appropriate chew toys provides the best preventive care. Regular professional cleanings become increasingly important with age.

English Cocker Spaniel Coat & Grooming

Coat type

Medium-length silky with feathering on ears, chest, belly, and legs

Shedding

moderate

Energy

high

English Cocker Spaniel Trainability

English Cocker Spaniels are rated easy to train. They typically calm down around 28 months of age.